PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN17478.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NAC
Protein Properties Length: 241aa    MW: 27227.6 Da    PI: 9.3572
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN17478.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.12.1e-46141411128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...k 96 
                 lppGfrF+Ptdeelv +yLk kv + +l++ ++i+e++++k++PwdLp ++  + +e +fFs+++ ky++g+r nr+tk gyWkatg+dk++ s+    
  KHN17478.1  14 LPPGFRFQPTDEELVFQYLKCKVFSYPLPA-SIIPEINVCKYDPWDLPGNC--DPQERHFFSPKEAKYRNGNRMNRTTKCGYWKATGSDKRISSStstC 109
                 79****************************.89***************544..67899***********************************986555 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                 +  vg++ktL+fy+g++pkg++t+Wv+heyrl
  KHN17478.1 110 NGIVGVRKTLIFYEGKSPKGSRTHWVLHEYRL 141
                 566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-5310170IPR003441NAC domain
PROSITE profilePS5100551.77114170IPR003441NAC domain
PfamPF023657.5E-2415141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEKLNFVKNG VSKLPPGFRF QPTDEELVFQ YLKCKVFSYP LPASIIPEIN VCKYDPWDLP  60
GNCDPQERHF FSPKEAKYRN GNRMNRTTKC GYWKATGSDK RISSSTSTCN GIVGVRKTLI  120
FYEGKSPKGS RTHWVLHEYR LVSVETGAAN SSHNYVNEIG DWVLCRLSMK KRSVESDGSG  180
THHKHRQNTA VQTTRPRLMF DFMMVGKTNS STSSSCSSSS NIMEVSSNAS DHEETSGYAH  240
F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-471417517170NO APICAL MERISTEM PROTEIN
1ut4_B1e-471417517170NO APICAL MERISTEM PROTEIN
1ut7_A1e-471417517170NO APICAL MERISTEM PROTEIN
1ut7_B1e-471417517170NO APICAL MERISTEM PROTEIN
3swm_A1e-471417520173NAC domain-containing protein 19
3swm_B1e-471417520173NAC domain-containing protein 19
3swm_C1e-471417520173NAC domain-containing protein 19
3swm_D1e-471417520173NAC domain-containing protein 19
3swp_A1e-471417520173NAC domain-containing protein 19
3swp_B1e-471417520173NAC domain-containing protein 19
3swp_C1e-471417520173NAC domain-containing protein 19
3swp_D1e-471417520173NAC domain-containing protein 19
4dul_A1e-471417517170NAC domain-containing protein 19
4dul_B1e-471417517170NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003525425.10.0PREDICTED: NAC domain-containing protein 83-like
SwissprotQ9FY937e-70NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A0B2QBQ20.0A0A0B2QBQ2_GLYSO; NAC domain-containing protein 29
TrEMBLI1K6Q90.0I1K6Q9_SOYBN; Uncharacterized protein
STRINGGLYMA05G38380.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.13e-70NAC domain containing protein 83
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]